rec IGF-II (1-67) (human)
rec IGF-II (1-67) (human)
Product description
rec IGF-II (1-67) (human),CAS: 96081-16-2 from ruixi.approx. ED₅₀ = 0.1 ng/mL IGF-II seems to be specifically involved in fetal growth, but otherwise shows similar biological activities to IGF-I.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 96081-16-2 |
Sequence | AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE |
Molecular Formula | C₃₂₁H₄₉₉N₉₃O₁₀₁S₆ |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product